PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.64KRI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 220aa    MW: 24236.2 Da    PI: 8.6345
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.64KRIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding331.4e-1081122647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
      Aradu.64KRI  81 EEEHRTFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 122
                      7****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.24775127IPR017930Myb domain
SMARTSM007170.001575125IPR001005SANT/Myb domain
PfamPF002492.9E-881122IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.6E-1481125IPR006447Myb domain, plants
CDDcd001671.18E-681123No hitNo description
Gene3DG3DSA:1.10.10.601.2E-781121IPR009057Homeodomain-like
SuperFamilySSF466897.8E-1381127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MGRKLFGVQL DISSSSCCVA MKKSFSMDSL PSSSSTTTTT SSFSSSRLPI DDNITLNNNN  60
SSAFGYLSDG LIVPPQDRKK EEEHRTFLVG LEKLGKGDWR GISRNYVTTR TPTQVASHAQ  120
KYFLRLATIN KKKRRSSLFD LVGIGNNNTK TEFHDAVGGI TNCKSGDSSV IVCNESKLEE  180
VVENNDIDHA TLSLLGRLTP FHQEIKSDND LKVRISPEVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130134KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086720.0KF208672.1 Arachis hypogaea putative MYB-related protein 18 (MYB18) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015966368.11e-133PREDICTED: uncharacterized protein LOC107490116
TrEMBLV5T6P81e-116V5T6P8_ARAHY; Putative MYB-related protein 18
STRINGGLYMA08G03330.11e-57(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-36MYB_related family protein